Sequence 1: | NP_477201.1 | Gene: | Dfd / 40832 | FlyBaseID: | FBgn0000439 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001231127.1 | Gene: | Pax6 / 18508 | MGIID: | 97490 | Length: | 436 | Species: | Mus musculus |
Alignment Length: | 259 | Identity: | 64/259 - (24%) |
---|---|---|---|
Similarity: | 91/259 - (35%) | Gaps: | 88/259 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 315 GSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQIL 379
Fly 380 ELEKEF---HYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDAN 441
Fly 442 GNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSL------- 499
Fly 500 ---------GNPPYIPAAPETTSSY--------------------PGSQQHLSNNNNNGSGNNN 534 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dfd | NP_477201.1 | Homeobox | 370..422 | CDD:278475 | 24/54 (44%) |
Pax6 | NP_001231127.1 | PAX | 4..142 | CDD:128645 | |
Homeobox | 228..281 | CDD:395001 | 25/55 (45%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |