DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and vab-15

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_509648.1 Gene:vab-15 / 181197 WormBaseID:WBGene00006881 Length:225 Species:Caenorhabditis elegans


Alignment Length:110 Identity:32/110 - (29%)
Similarity:55/110 - (50%) Gaps:13/110 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 SDSDEDLMAETTDGERIIYPWMK------------KIHVAGVANGSYQPGMEPKRQRTAYTRHQI 378
            |||..:..|.:....:....|:.            ||.: |::....:.....::.||.::..|:
 Worm    78 SDSSPESCASSPLSMQHSLQWLSSQREDSPTSDDAKIQI-GLSKCMLRKHKNNRKPRTPFSTQQL 141

  Fly   379 LELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
            :.||::|...:||:...|.|.:.:|.|:|.|:||||||||.|.|:
 Worm   142 ISLERKFQSKQYLSIAERAEFSASLQLTETQVKIWFQNRRAKSKR 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 23/51 (45%)
vab-15NP_509648.1 Homeobox 132..185 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.