DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Msx3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_034966.1 Gene:Msx3 / 17703 MGIID:106587 Length:204 Species:Mus musculus


Alignment Length:94 Identity:35/94 - (37%)
Similarity:54/94 - (57%) Gaps:3/94 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK--DNKLPN 429
            ::.||.:|..|:|.||::||..:||:...|.|.:.:|.|:|.|:||||||||.|.|:  :.:|..
Mouse    88 RKPRTPFTTAQLLALERKFHQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEK 152

  Fly   430 TKNVRKKTVDAN-GNPTPVAKKPTKRAAS 457
            .|...|..:.|. ..|.|:..:....||:
Mouse   153 LKLAAKPLLPAAFALPFPLGTQLHSSAAT 181

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)