DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Msx2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus


Alignment Length:291 Identity:71/291 - (24%)
Similarity:106/291 - (36%) Gaps:96/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 GGGAVGGSANG--YYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQ----CSSTEPPTNTAL 257
            ||........|  ...|.|.|.|.|.||       ......::..||..    .|..:||..:  
Mouse     7 GGDLFSSDEEGPAVLAGPGPGPGGAEGS-------AEERRVKVSSLPFSVEALMSDKKPPKES-- 62

  Fly   258 GLQELGLKLEKRIEEAVP-----AGQQLQEL-----GMRLRCDDMGSENDDMSEEDRLMLDRSPD 312
                          .|||     ||..|:.|     |:|           |......|:   .|.
Mouse    63 --------------PAVPPDCASAGAVLRPLLLPGHGVR-----------DAHSPGPLV---KPF 99

  Fly   313 ELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQP---GMEP-------- 366
            |..|..:::              :.||.    ||:::       .|.|.|   .|.|        
Mouse   100 ETASVKSEN--------------SEDGA----PWIQE-------PGRYSPPPRHMSPTTCTLRKH 139

  Fly   367 ---KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK--DNK 426
               ::.||.:|..|:|.||::|...:||:...|.|.:.:|.|:|.|:||||||||.|.|:  :.:
Mouse   140 KTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAE 204

  Fly   427 LPNTKNVRKKTVDANGN-PTPVAKKPTKRAA 456
            |...|...|..:.:..: |.|: ..|.:.|:
Mouse   205 LEKLKMAAKPMLPSGFSLPFPI-NSPLQAAS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 10/41 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132 8/52 (15%)
Homeobox 145..198 CDD:306543 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.