DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and vab-7

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_499401.1 Gene:vab-7 / 176521 WormBaseID:WBGene00006873 Length:247 Species:Caenorhabditis elegans


Alignment Length:210 Identity:52/210 - (24%)
Similarity:87/210 - (41%) Gaps:41/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 AGVANGSYQP-----GMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKI 412
            |..|.|.:.|     ..:.:|.|||::|.||..||:||....|::|:.|.|:|..|.|.|..||:
 Worm    50 AAAAAGRHHPYDNRDDGQMRRYRTAFSREQIGRLEREFAKENYVSRKTRGELAAELNLPEGTIKV 114

  Fly   413 WFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQT 477
            ||||||||.|:..              ..|...|.   |.:.||......|.:........:|  
 Worm   115 WFQNRRMKDKRQR--------------VGGLAWPF---PPQMAAYMLNPFAYEMWMKTAAASQ-- 160

  Fly   478 PVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYP-----GSQQHLSNNNNNGSGNNNNNN 537
                       ..:.|..:.:.||.. ...:|....|.|     |....||.|:.....:.::::
 Worm   161 -----------FGATGPGNGAYGNNG-SSTSPSAAGSLPFLPPLGFPSFLSQNSTKSPSSPHSDD 213

  Fly   538 NNNNSNLNNNNNNNQ 552
            ::.:.|.:::::.::
 Worm   214 SSKSKNTSSDDDESK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 28/51 (55%)
vab-7NP_499401.1 Homeobox 72..124 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.