DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Meox1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_036012267.1 Gene:Meox1 / 17285 MGIID:103220 Length:271 Species:Mus musculus


Alignment Length:254 Identity:58/254 - (22%)
Similarity:81/254 - (31%) Gaps:72/254 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NPHSHSHSHTHSLPHHHSNSAISGHHQ------ASAGGYSSNYANATPPSHPHS-------HPHA 146
            ||||...|  .|...|:..:..|.|.:      |:...:|::...|||.|.|.:       || |
Mouse    24 NPHSEDSS--ASGLSHYPPTPFSFHQKSDFPATAAYPDFSASCLAATPHSLPRTERIFNEQHP-A 85

  Fly   147 HPHQSLGYY-VHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLG----------- 199
            .|.....:: :..|.:.::.|...|....|.|....|..|:   |.|....|||           
Mouse    86 FPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTA---GLGEDCMVLGTIANETEKKSS 147

  Fly   200 -------GGAV------------GGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQ 245
                   |.::            ||||....|....|:|..:.|.............::.:.|||
Mouse   148 RRKKERSGQSLVPEPEDEVETCEGGSACVPTGAGPRGWGLCSFSKFRVRCSKDQNQERLKEPPLQ 212

  Fly   246 CSSTEP-----------PTNT----------ALGLQELGLKLEKRIEEAVPAGQQLQEL 283
            .....|           |.:|          ||...| ||.....|..|...|.||..|
Mouse   213 FPPPGPTLSHLWTHPGQPAHTLRCEVAQYVGALNFPE-GLAQRPYISAAPSPGLQLPTL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475
Meox1XP_036012267.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.