DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and ceh-12

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_491693.1 Gene:ceh-12 / 172255 WormBaseID:WBGene00000436 Length:180 Species:Caenorhabditis elegans


Alignment Length:152 Identity:48/152 - (31%)
Similarity:75/152 - (49%) Gaps:22/152 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 SENDDM-------------------SEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDG 339
            |:|:|.                   |||...|..::.........::....|.|....:...:..
 Worm    16 SQNEDQKLESHPSPPSQIPNYSTSCSEELMKMAAKAAQFAAQASLENSFSSSTSPTSTVTPLSAY 80

  Fly   340 ERIIYPWMKKI--HVA-GVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAH 401
            ..::.|.:..|  |:| ..:..::|...:.:|.|||::..|:::|||:|..||||:|.||.::|.
 Worm    81 TSLVQPVLPLIYDHLALTYSVNAWQAWGKMRRPRTAFSSEQLVQLEKQFSDNRYLSRPRRYQLAQ 145

  Fly   402 TLVLSERQIKIWFQNRRMKWKK 423
            .|.|||.||||||||||||.|:
 Worm   146 QLSLSETQIKIWFQNRRMKNKR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 32/51 (63%)
ceh-12NP_491693.1 Homeobox 113..166 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.