DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and GSX2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_573574.2 Gene:GSX2 / 170825 HGNCID:24959 Length:304 Species:Homo sapiens


Alignment Length:396 Identity:94/396 - (23%)
Similarity:121/396 - (30%) Gaps:195/396 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PLADDYHHYNGHYSMTASTGHMSGAVGGGAGVGSVGGGGAGGMTGHPHSMHPADMVSDYMAHHHN 95
            ||....|.::...|:.|.:|      |.||||...||.|..|..|                    
Human    62 PLCVTSHLHSSRGSVGAGSG------GAGAGVTGAGGSGVAGAAG-------------------- 100

  Fly    96 PHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAP 160
                      :||      .:.|...::.|  .:.:......:|.|.||..|.|.      ||.|
Human   101 ----------ALP------LLKGQFSSAPG--DAQFCPRVNHAHHHHHPPQHHHH------HHQP 141

  Fly   161 EFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSV 225
            :         .|                    ||.|.....|...:|....|             
Human   142 Q---------QP--------------------GSAAAAAAAAAAAAAAAALG------------- 164

  Fly   226 GSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCD 290
               |.|.|:|         .|::|  ..|.|          :.|                |..|.
Human   165 ---HPQHHAP---------VCTAT--TYNVA----------DPR----------------RFHCL 189

  Fly   291 DMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGV 355
            .||.                               ||:.:                        |
Human   190 TMGG-------------------------------SDASQ------------------------V 199

  Fly   356 ANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMK 420
            .||        ||.|||:|..|:||||:||..|.||:|.||||||..|.|||:|:||||||||:|
Human   200 PNG--------KRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVK 256

  Fly   421 WKKDNK 426
            .||:.|
Human   257 HKKEGK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
GSX2NP_573574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 13/69 (19%)
Homeobox 206..258 CDD:306543 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.