DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and ARX

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_620689.1 Gene:ARX / 170302 HGNCID:18060 Length:562 Species:Homo sapiens


Alignment Length:328 Identity:78/328 - (23%)
Similarity:119/328 - (36%) Gaps:75/328 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 ASAGGYSSNYANATPPSHPHSHPHAHPHQSLG---------------YYVHHAPEFISAGAVHSD 171
            |:|...:.....|.||..|.:.|...| ...|               ..:..||: :|.....|.
Human   113 AAATATAGPRGEAPPPPPPTARPGERP-DGAGAAAAAAAAAAAAWDTLKISQAPQ-VSISRSKSY 175

  Fly   172 PTNGYGPAANVPNTSN--GGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHS 234
            ..|| .|....|...:  ||.||.:......|..||.  |.....|||.||.:........:...
Human   176 RENG-APFVPPPPALDELGGPGGVTHPEERLGVAGGP--GSAPAAGGGTGTEDDEEELLEDEEDE 237

  Fly   235 PHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDM 299
            ...:.:   |:....|...:.|..|    ||..:|...|............      :.:|..::
Human   238 DEEEEL---LEDDEEELLEDDARAL----LKEPRRCPVAATGAVAAAAAAA------VATEGGEL 289

  Fly   300 SEEDRLMLDRSPDELGSNDNDDDL---GDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQ 361
            |.::.|:|  .|::....|.:|.:   ..|||:|.|:..                          
Human   290 SPKEELLL--HPEDAEGKDGEDSVCLSAGSDSEEGLLKR-------------------------- 326

  Fly   362 PGMEPKRQRTAYTRHQILELEKEF---HYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
               :.:|.||.:|.:|:.|||:.|   ||....||.   |:|..|.|:|.::::||||||.||:|
Human   327 ---KQRRYRTTFTSYQLEELERAFQKTHYPDVFTRE---ELAMRLDLTEARVQVWFQNRRAKWRK 385

  Fly   424 DNK 426
            ..|
Human   386 REK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 24/54 (44%)
ARXNP_620689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..81
GCG-encoded polyalanine repeat 102..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..255 30/144 (21%)
Homeobox 332..385 CDD:395001 25/55 (45%)
OAR 526..544 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 530..543
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.