DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and NKX2-3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_660328.2 Gene:NKX2-3 / 159296 HGNCID:7836 Length:364 Species:Homo sapiens


Alignment Length:328 Identity:76/328 - (23%)
Similarity:121/328 - (36%) Gaps:92/328 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 MDLPLQCSSTEPPTNTALGLQEL-----GLKLEKRIEE---------AVPAGQQLQELGMRLRCD 290
            |.||...:||.......|.|::.     |..|:..:|.         |...|.|..:        
Human     1 MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSD-------- 57

  Fly   291 DMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLG------------DSDSD----EDLMAETTDG 339
              |.|.|:..|.::|....|   |.:.|...|.|            ||.|:    |:......|.
Human    58 --GGEEDEEDEGEKLSYLNS---LAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDR 117

  Fly   340 ERIIYPWMKKIHVAG---VANGSYQPGMEPKRQ-RTAYTRHQILELEKEFHYNRYLTRRRRIEIA 400
            .:......|.:..||   .|..|.:|....:|: |..:::.|:.|||:.|...|||:...|..:|
Human   118 SQKSCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLA 182

  Fly   401 HTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQ 465
            .:|.|:..|:||||||||.|.|:..        :.|:::...:..|   .|.:|.|         
Human   183 SSLKLTSTQVKIWFQNRRYKCKRQR--------QDKSLELGAHAPP---PPPRRVA--------- 227

  Fly   466 QQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGS 530
                       .||:   :| |....:...:.:.|.|..:.|:..:.:|:|.          .|.
Human   228 -----------VPVL---VR-DGKPCVTPSAQAYGAPYSVGASAYSYNSFPA----------YGY 267

  Fly   531 GNN 533
            ||:
Human   268 GNS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 23/51 (45%)
NKX2-3NP_660328.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..153 5/20 (25%)
HOX 148..204 CDD:197696 24/55 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.