DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxd1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus


Alignment Length:463 Identity:106/463 - (22%)
Similarity:148/463 - (31%) Gaps:190/463 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MTASTGHMSGAVGGGAGVGSVGGGGAG------GMTGHPHSMHPADMVSDYMAHHHNPHSHSHSH 103
            |::...::|.|.|||:  |.|||...|      .....|.::.||..:.                
Mouse     1 MSSYLEYVSCAAGGGS--GGVGGDVLGFAPKFCRADARPVALQPAFPLG---------------- 47

  Fly   104 THSLPHHHSNSAISGHHQASAGGYSSNYANAT------PPSHPHSHPHAHPHQSLGYYVHHAPEF 162
                         ||.     |.:.|....||      ||:.|...|...|         .||.:
Mouse    48 -------------SGD-----GAFVSCLPLATARPTPSPPAGPAQSPVPQP---------AAPRY 85

  Fly   163 --------ISAGAVHSDPTN----GYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYG 215
                    ...||..:....    |.|||.:.|      |..|..|..||..|..:.:..:.  |
Mouse    86 APCTLEGAYERGAAPASAAEYGFLGSGPAFDFP------GALGRAADEGGAHVHYATSAVFS--G 142

  Fly   216 GGYGTANGSVG--------------STHSQGH-SPHSQMMDLPLQCSSTEPPTNTALGLQELGLK 265
            ||....:|.|.              ...:.|| .|...:...|..|.....||:           
Mouse   143 GGSFLLSGQVDFAAFGEPGPFPACLKEPADGHPGPFQTVSPAPGACPKPASPTS----------- 196

  Fly   266 LEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDE 330
                   ::||                                                      
Mouse   197 -------SLPA------------------------------------------------------ 200

  Fly   331 DLMAETTDGERIIYPWMKKIHVAGVAN--GSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTR 393
               |.:|      :.|||....|...:  ..|.....|...||.::..|:.|||||||:|:||||
Mouse   201 ---AHST------FEWMKVKRNAPKKSKLSEYGATSPPSAIRTNFSTKQLTELEKEFHFNKYLTR 256

  Fly   394 RRRIEIAHTLVLSERQIKIWFQNRRMKWKKDN--------------KLPNTKNVRKKTVDANGNP 444
            .||||||:.|.|::.|:||||||||||.||..              |||.::....|:....|:|
Mouse   257 ARRIEIANCLQLNDTQVKIWFQNRRMKQKKREREGLLATAASVASIKLPRSETSPIKSGRNLGSP 321

  Fly   445 TPVAKKPT 452
            :. |::|:
Mouse   322 SQ-AQEPS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134 11/54 (20%)
Antp-type hexapeptide 204..209 2/10 (20%)
Homeobox 233..285 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.