DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxc9

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_032298.1 Gene:Hoxc9 / 15427 MGIID:96199 Length:260 Species:Mus musculus


Alignment Length:162 Identity:64/162 - (39%)
Similarity:79/162 - (48%) Gaps:29/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 PAGQQLQEL------GMRLRC--DDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDE- 330
            |||.:...|      |.|..|  .|..|..|.|......:.||:|..|.|.:.|...|....:| 
Mouse   110 PAGGRHYALKPDAYPGRRADCGPGDGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEK 174

  Fly   331 -DLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRR 394
             ||     |....:..|   ||....           :::|..||::|.|||||||.:|.||||.
Mouse   175 ADL-----DPSNPVANW---IHARST-----------RKKRCPYTKYQTLELEKEFLFNMYLTRD 220

  Fly   395 RRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK 426
            ||.|:|..|.|:|||:||||||||||.||.||
Mouse   221 RRYEVARVLNLTERQVKIWFQNRRMKMKKMNK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
Hoxc9NP_032298.1 Hox9_act 1..179 CDD:398350 21/73 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..182 18/66 (27%)
HOX 192..241 CDD:197696 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.