DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxc6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_006520531.1 Gene:Hoxc6 / 15425 MGIID:96197 Length:243 Species:Mus musculus


Alignment Length:183 Identity:77/183 - (42%)
Similarity:103/183 - (56%) Gaps:19/183 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 DMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERI-IYPWMKKIH--- 351
            |.|| |....|:|.|...|. :.||.|.......|..|::...|.......| |||||::::   
Mouse    71 DYGS-NSFYQEKDMLSNCRQ-NTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHS 133

  Fly   352 ---VAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIW 413
               |.|.....|  |.:.:|.|..|:|:|.||||||||:|||||||||||||:.|.|:|||||||
Mouse   134 VCFVPGSLGVGY--GADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIW 196

  Fly   414 FQNRRMKWKKDNKLPNTKNVRKKTVDANGNPT--PVAKKPTKRAASKKQQQAQ 464
            ||||||||||::.|.:|.:      ...|..|  .:..|..||..:::::|.:
Mouse   197 FQNRRMKWKKESNLTSTLS------GGGGGATADSLGGKEEKREETEEEKQKE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 41/51 (80%)
Hoxc6XP_006520531.1 Homeobox 153..206 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.