DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxc5

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus


Alignment Length:231 Identity:84/231 - (36%)
Similarity:109/231 - (47%) Gaps:30/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 ANGYY------GGYG----GGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQE 261
            ||.:|      ..|.    |.||:|:....|.:..|          .|..|.|.||...:..|..
Mouse     6 ANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYG----------GLDLSITFPPPAPSNSLHG 60

  Fly   262 LGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDS 326
            :.:....|.....||.......|..|..|:....|..|..:.............|.:..::...:
Mouse    61 VDMAANPRAHPDRPACSAAAAPGHALGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQT 125

  Fly   327 DSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYL 391
            .....|.......:  |||||.|:|::...:|        ||.||:|||:|.||||||||:||||
Mouse   126 GQPAGLSQPPAPPQ--IYPWMTKLHMSHETDG--------KRSRTSYTRYQTLELEKEFHFNRYL 180

  Fly   392 TRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL 427
            |||||||||:.|.|:||||||||||||||||||:|:
Mouse   181 TRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKM 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 43/51 (84%)
Hoxc5NP_783857.1 COG5373 65..>142 CDD:227665 11/78 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 10/74 (14%)
Antp-type hexapeptide 140..145 4/4 (100%)
Homeobox 158..212 CDD:395001 44/53 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.