DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxc4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_038581.2 Gene:Hoxc4 / 15423 MGIID:96195 Length:264 Species:Mus musculus


Alignment Length:278 Identity:107/278 - (38%)
Similarity:130/278 - (46%) Gaps:66/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 SANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLP-----------LQCSSTEPPTNTALGL 259
            |.|.|...:...|      .|.|...|...|.|.:..|           ..|:|.:.|.|:    
Mouse    24 SQNSYIPEHSPEY------YGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNS---- 78

  Fly   260 QELGLKLEKRIEEAVPAGQQLQELGMRLRCD--DMGSENDDMSEEDRLMLDRSPDELGSNDNDDD 322
                     |......||....|....| |:  .:...:...|.........:||...|      
Mouse    79 ---------RAHGPAQAGHHHPEKSQPL-CEPAPLSGTSASPSPAPPACSQPAPDHPSS------ 127

  Fly   323 LGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHY 387
                         ....:.|:|||||||||:.| |.:|..| ||||.||||||.|:|||||||||
Mouse   128 -------------AASKQPIVYPWMKKIHVSTV-NPNYNGG-EPKRSRTAYTRQQVLELEKEFHY 177

  Fly   388 NRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRK--------KTVDANGNP 444
            ||||||||||||||:|.||||||||||||||||||||::||||| ||.        .|:.|   .
Mouse   178 NRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTK-VRSAPPAGAAPSTLSA---A 238

  Fly   445 TPVAKKPTKRAASKKQQQ 462
            ||...:...::|:..:||
Mouse   239 TPGTSEDHSQSATPPEQQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 47/51 (92%)
Hoxc4NP_038581.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..130 24/144 (17%)
Antp-type hexapeptide 135..140 3/4 (75%)
Homeobox 159..213 CDD:365835 48/53 (91%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..264 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6182
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3861
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4536
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.