DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb8

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_034591.1 Gene:Hoxb8 / 15416 MGIID:96189 Length:243 Species:Mus musculus


Alignment Length:127 Identity:54/127 - (42%)
Similarity:77/127 - (60%) Gaps:24/127 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 IYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSE 407
            ::|||:....||           .:|.|..|:|:|.|||||||.:|.||||:||||::|.|.|:|
Mouse   134 LFPWMRPQAAAG-----------RRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTE 187

  Fly   408 RQIKIWFQNRRMKWKKDN---KLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQ 466
            ||:|||||||||||||:|   |.|::|..:::          :.|:..:||....:|...|:
Mouse   188 RQVKIWFQNRRMKWKKENNKDKFPSSKCEQEE----------LEKEKLERAPETAEQGDAQK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
Hoxb8NP_034591.1 Antp-type hexapeptide 134..139 2/4 (50%)
Homeobox 150..203 CDD:395001 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.