DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_006532355.1 Gene:Hoxb6 / 15414 MGIID:96187 Length:309 Species:Mus musculus


Alignment Length:339 Identity:101/339 - (29%)
Similarity:133/339 - (39%) Gaps:103/339 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SLPHHHSNSAISGHHQASAGGYSSNY--ANATPPSHPHSHPHAHPHQSLGYYVHHA-PEFISAG- 166
            |||.|...|....:..:||....|:|  .....|:. ...|.|.|.....|:|:.. |..:::| 
Mouse    40 SLPPHPFESGGGQNPPSSAKARRSDYKTQQIINPAE-QQRPRAPPLPMSSYFVNSTFPVTLASGQ 103

  Fly   167 -----------AVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGT 220
                       :.::||...| ||...|..              |...|.:|:.||...||||| 
Mouse   104 ESFLGQLPLYSSGYADPLRHY-PAPYGPGP--------------GQDKGFAASSYYPPAGGGYG- 152

  Fly   221 ANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGM 285
                                                               .|.|.         
Mouse   153 ---------------------------------------------------RAAPC--------- 157

  Fly   286 RLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGE--RIIYPWMK 348
                 |.|.......|:|........||......:....|...|:.:..||.:.:  ..:||||:
Mouse   158 -----DYGPAPAFYREKDAACALSGADEPPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQ 217

  Fly   349 KIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIW 413
            :::...  :.|:.|  ..:|.|..|||:|.|||||||||||||||||||||||.|.|:|||||||
Mouse   218 RMNSCN--SSSFGP--SGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIW 278

  Fly   414 FQNRRMKWKKDNKL 427
            ||||||||||::||
Mouse   279 FQNRRMKWKKESKL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 44/51 (86%)
Hoxb6XP_006532355.1 Homeobox 235..288 CDD:365835 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.