DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb5

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_032294.2 Gene:Hoxb5 / 15413 MGIID:96186 Length:269 Species:Mus musculus


Alignment Length:259 Identity:98/259 - (37%)
Similarity:125/259 - (48%) Gaps:52/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 GSGAVLGGGAVGGSANGYYGGYGGGYGTANG--------SVGSTHSQGHSPHSQMMDLPLQ---- 245
            |||:.| .|:....|..:.|.||..|   ||        |..|:|.......|:......|    
Mouse    25 GSGSSL-SGSYRDPAAMHTGSYGYNY---NGMDLSVNRSSASSSHFGAVGESSRAFPASAQEPRF 85

  Fly   246 ------CSSTEPPTNTALGLQELGLK--LEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEE 302
                  ||.:.|.:.........|.|  .....::|.||                 |.:.:.:|.
Mouse    86 RQATSSCSLSSPESLPCTNGDSHGAKPSASSPSDQATPA-----------------SSSANFTEI 133

  Fly   303 DRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETT---DGER-IIYPWMKKIHVAGVANGSYQPG 363
            |.......|:|..|..:...|..:..:.  ||.:|   :|:. .|:|||:|:|::     ....|
Mouse   134 DEASASSEPEEAASQLSSPSLARAQPEP--MATSTAAPEGQTPQIFPWMRKLHIS-----HDMTG 191

  Fly   364 MEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL 427
            .:.||.||||||:|.||||||||:||||||||||||||.|.|||||||||||||||||||||||
Mouse   192 PDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 46/51 (90%)
Hoxb5NP_032294.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..173 20/116 (17%)
Antp-type hexapeptide 176..181 3/4 (75%)
Homeobox 198..251 CDD:365835 47/52 (90%)
PRK07003 <67..>171 CDD:235906 20/122 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.