DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus


Alignment Length:105 Identity:76/105 - (72%)
Similarity:85/105 - (80%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 ERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLV 404
            |.::||||:|:||:.| |.:|..| ||||.||||||.|:||||||||||||||||||:||||.|.
Mouse   137 EPVVYPWMRKVHVSTV-NPNYAGG-EPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALC 199

  Fly   405 LSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNP 444
            ||||||||||||||||||||:||||||.....|..|.|.|
Mouse   200 LSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGTAGAAGGP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 46/51 (90%)
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
Antp-type hexapeptide 140..145 3/4 (75%)
Homeobox 164..218 CDD:395001 47/53 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 11/21 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6182
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3861
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4536
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.