DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_006532343.1 Gene:Hoxb1 / 15407 MGIID:96182 Length:330 Species:Mus musculus


Alignment Length:303 Identity:92/303 - (30%)
Similarity:123/303 - (40%) Gaps:86/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PHAHPHQSLGYYVHHAPEFISAGAVHSDPT-NGYGPAANVPN----------TSNGGGG----GG 193
            |.:...|:.||.|...|.  |.|.....|. :||.|||..|:          .|.|.|.    ..
Mouse    50 PSSALQQNSGYPVQQPPS--SLGVSFPSPAPSGYAPAACNPSYGPSQYYSVGQSEGDGSYFHPSS 112

  Fly   194 SGAVLGG-----GAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPT 253
            .||.|||     || ||..:|.|......|||..   .:|.:..:...|:..:.|  ||| ||.|
Mouse   113 YGAQLGGLPDSYGA-GGVGSGPYPPPQPPYGTEQ---TATFASAYDLLSEDKESP--CSS-EPST 170

  Fly   254 NTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSND 318
            .|....                                           |.:.:.|:|.:.|...
Mouse   171 LTPRTF-------------------------------------------DWMKVKRNPPKTGRAQ 192

  Fly   319 NDDDLGDSDSDEDLMAETTDG-ERIIYPWMKKIHVAGVAN--GSYQPGMEPKRQRTAYTRHQILE 380
            ....|       .|....|:| |..::.:::.:.:|...:  |...||    ..||.:|..|:.|
Mouse   193 RSHFL-------SLARAYTEGPEPGLHSFLQLLLLAAKVSELGLGAPG----GLRTNFTTRQLTE 246

  Fly   381 LEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
            ||||||:|:||:|.||:|||.||.|:|.|:||||||||||.||
Mouse   247 LEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
Hoxb1XP_006532343.1 Homeobox 236..289 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.