DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxa5

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_034583.1 Gene:Hoxa5 / 15402 MGIID:96177 Length:270 Species:Mus musculus


Alignment Length:357 Identity:111/357 - (31%)
Similarity:142/357 - (39%) Gaps:135/357 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 DYMAHHHNPHS----------HSHSHTHSLPHHHSNSAI----SGHHQASAGGYSSNY---ANAT 135
            ||..|::..||          ..||..:...::..:.::    |||.  .:|..:.:|   |:|.
Mouse    18 DYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHF--GSGERARSYAAGASAA 80

  Fly   136 PPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGG 200
            |....:|.|                    |.:.||.|.:....:|..|:..:....||..::  |
Mouse    81 PAEPRYSQP--------------------ATSTHSPPPDPLPCSAVAPSPGSDSHHGGKNSL--G 123

  Fly   201 GAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLK 265
            .:.|.|||                .||||                .||.|            |:.
Mouse   124 NSSGASAN----------------AGSTH----------------ISSRE------------GVG 144

  Fly   266 LEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDE 330
            .....||..||.                      ||:.....:.||                   
Mouse   145 TASAAEEDAPAS----------------------SEQAGAQSEPSP------------------- 168

  Fly   331 DLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRR 395
                 ....:..|||||:|:|::....|    |.|.||.||||||:|.||||||||:||||||||
Mouse   169 -----APPAQPQIYPWMRKLHISHDNIG----GPEGKRARTAYTRYQTLELEKEFHFNRYLTRRR 224

  Fly   396 RIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL 427
            ||||||.|.|||||||||||||||||||||||
Mouse   225 RIEIAHALCLSERQIKIWFQNRRMKWKKDNKL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 46/51 (90%)
Hoxa5NP_034583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 34/211 (16%)
Antp-type hexapeptide 176..181 4/4 (100%)
Homeobox 199..252 CDD:333795 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.