DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxa2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_034581.1 Gene:Hoxa2 / 15399 MGIID:96174 Length:372 Species:Mus musculus


Alignment Length:234 Identity:72/234 - (30%)
Similarity:98/234 - (41%) Gaps:62/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 YPWMKKIHVA-----------------------GVANGSYQPGMEPKRQRTAYTRHQILELEKEF 385
            |||||:...|                       .:|:||   |...:|.|||||..|:|||||||
Mouse    97 YPWMKEKKAAKKTALPPAAASTGPACLGHKESLEIADGS---GGGSRRLRTAYTNTQLLELEKEF 158

  Fly   386 HYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGN------- 443
            |:|:||.|.||:|||..|.|:|||:|:||||||||.|:..:....:|...|..:...:       
Mouse   159 HFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDE 223

  Fly   444 --------PTPVAKKPTKRAASKKQQQAQQQQQS---QQQQTQQTPVMNECIRSDSLESIGDVSS 497
                    ...|:....:|.....||.|..|||:   ....:|..||........:|:.....| 
Mouse   224 EEKSLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQTFPVSPLTSNEKNLKHFQHQS- 287

  Fly   498 SLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGSGNNNNN 536
                    |..|...|:.         ..|.|:|.||::
Mouse   288 --------PTVPNCLSTM---------GQNCGAGLNNDS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 37/51 (73%)
Hoxa2NP_034581.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95
Antp-type hexapeptide 96..101 3/3 (100%)
Homeobox 143..195 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 3/30 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.