DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hmx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_034575.1 Gene:Hmx1 / 15371 MGIID:107178 Length:332 Species:Mus musculus


Alignment Length:257 Identity:68/257 - (26%)
Similarity:93/257 - (36%) Gaps:89/257 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 GYGPAANVPNTSNGGG-----GGGSGAVLGGGAVGGSANGY---YGGYGGGYGTANGSVGSTHSQ 231
            |.||.......:.|.|     |.|....||   .||:...|   :||||||.             
Mouse    73 GSGPGGEARARALGLGPRPPPGPGPPFALG---CGGTTRWYPRVHGGYGGGL------------- 121

  Fly   232 GHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSEN 296
              ||.:...|        .|.|...:|          |.|.|.|            ||...|:..
Mouse   122 --SPDTSDRD--------SPETGEEMG----------RAESAWP------------RCPGPGTVP 154

  Fly   297 DDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQ 361
            .:::.:                     |.:...|: .||..:...          ||..|.|..:
Mouse   155 REVTTQ---------------------GPATGGEE-AAELAEAPA----------VAAAATGEAR 187

  Fly   362 PGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
            .|.. |:.||.::|.|:.:||..|...|||:...|..:|.:|.|:|.|:||||||||.|||:
Mouse   188 GGRR-KKTRTVFSRSQVFQLESTFDLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
Hmx1NP_034575.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..170 33/166 (20%)
Homeobox 194..247 CDD:278475 25/52 (48%)
HMX family specific domain 1 251..261
HMX family specific domain 2 264..277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.