DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Gbx2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_034392.1 Gene:Gbx2 / 14472 MGIID:95668 Length:348 Species:Mus musculus


Alignment Length:356 Identity:94/356 - (26%)
Similarity:126/356 - (35%) Gaps:100/356 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ATPPSHPHSHPHAHPHQSLGYYVHHA-------------PEFISAGAVHSDPTNGYGPAAN--VP 183
            |.||:|||   |..|....|:....|             |...||...|.:     ..||.  .|
Mouse    73 ALPPAHPH---HQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE-----AAAARKFAP 129

  Fly   184 NTSNGGGGGGSGAVLGGGAVGGSA----NGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPL 244
            ....|||.......|...|..|.|    .|....:..........||:...||            
Mouse   130 QPLPGGGNFDKAEALQADAEDGKAFLAKEGSLLAFSAAEAVQASLVGAVRGQG------------ 182

  Fly   245 QCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDR 309
                                |.|.::|:                 |..|.|.....|.|      
Mouse   183 --------------------KDESKVED-----------------DPKGKEESFSLESD------ 204

  Fly   310 SPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYT 374
                          .|..||::|..:|...|......:::...:|.|.||.....:.:|:|||:|
Mouse   205 --------------VDYSSDDNLPGQTAHKEEDPGHALEETPQSGGAAGSTTSTGKNRRRRTAFT 255

  Fly   375 RHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVD 439
            ..|:||||||||..:||:...|.:|||.|.|||.|:||||||||.|||:    ....|...||.:
Mouse   256 SEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKR----VKAGNANSKTGE 316

  Fly   440 ANGNPTPVAKKPTKRAASKKQQQAQQQQQSQ 470
            .:.||..|...|...:....:.|.||.:|::
Mouse   317 PSRNPKIVVPIPVHVSRFAIRSQHQQLEQAR 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 33/51 (65%)
Gbx2NP_034392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81 6/10 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139 9/32 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 21/140 (15%)
Homeobox 250..304 CDD:395001 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.