Sequence 1: | NP_477201.1 | Gene: | Dfd / 40832 | FlyBaseID: | FBgn0000439 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017175446.1 | Gene: | Dmbx1 / 140477 | MGIID: | 2153518 | Length: | 389 | Species: | Mus musculus |
Alignment Length: | 216 | Identity: | 51/216 - (23%) |
---|---|---|---|
Similarity: | 90/216 - (41%) | Gaps: | 65/216 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 367 KRQRTAYTRHQILELEKEF---HYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLP 428
Fly 429 NTKNVRKK----------TVDANGNPT----------PVAKKPTKRAASKKQQQA---------- 463
Fly 464 -QQQQQSQQQQTQQTPVMNE----CIR-SDSLESIGDVSSSLGNPPYIPAAP--------ETTSS 514
Fly 515 YPGS--------QQHLSNNNN 527 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dfd | NP_477201.1 | Homeobox | 370..422 | CDD:278475 | 22/54 (41%) |
Dmbx1 | XP_017175446.1 | Homeobox | 82..136 | CDD:365835 | 22/56 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |