DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and NKX2-6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001129743.2 Gene:NKX2-6 / 137814 HGNCID:32940 Length:301 Species:Homo sapiens


Alignment Length:297 Identity:72/297 - (24%)
Similarity:108/297 - (36%) Gaps:98/297 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 PPTNTALGLQELGLKLEKRIEEAVPAG----------QQLQELGMRLRCDDMGSENDDMSEEDRL 305
            |.|:|...:::: |:||:  |.:.||.          :..|.|  |:..:..|||          
Human     5 PVTSTPFSVKDI-LRLER--ERSCPAASPHPRVRKSPENFQYL--RMDAEPRGSE---------- 54

  Fly   306 MLDRSPDELGSNDNDDDLGDS-----------DSDEDLMAETTDGERIIYP--WMKKIHVAGVAN 357
                 ....|....|..|..|           :.|.:.|.|...|.....|  ...::...||.|
Human    55 -----VHNAGGGGGDRKLDGSEPPGGPCEAVLEMDAERMGEPQPGLNAASPLGGGTRVPERGVGN 114

  Fly   358 G--------SYQPGMEPKRQ-RTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIW 413
            .        |.||....:|: |..:::.|:|.||:.|...|||:...|..:|..|.|:..|:|||
Human   115 SGDSVRGGRSEQPKARQRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASALQLTSTQVKIW 179

  Fly   414 FQNRRMKWKKDNKLPNTKNVRKKTVDANGNP-TPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQT 477
            |||||.|.|:..        :.|:::..|:| ||      :|.|                    .
Human   180 FQNRRYKCKRQR--------QDKSLELAGHPLTP------RRVA--------------------V 210

  Fly   478 PVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSS 514
            ||:           :.|....||..|..||.|...|:
Human   211 PVL-----------VRDGKPCLGPGPGAPAFPSPYSA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 23/51 (45%)
NKX2-6NP_001129743.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..135 25/129 (19%)
HOX 132..188 CDD:197696 24/55 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.