DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Dlx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_034183.1 Gene:Dlx1 / 13390 MGIID:94901 Length:255 Species:Mus musculus


Alignment Length:414 Identity:83/414 - (20%)
Similarity:127/414 - (30%) Gaps:184/414 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NSAISGHHQASAGGYSSNYANATPPSHPHS-HPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGY 176
            ||.:||         .:.:....||:...| .|.:|.|.|: :.:|      |||  ||.|...|
Mouse    11 NSPVSG---------KAVFMEFGPPNQQMSPSPMSHGHYSM-HCLH------SAG--HSQPDGAY 57

  Fly   177 GPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMD 241
                                        .||:.:....|..|      |.|..|...||:...: 
Mouse    58 ----------------------------SSASSFSRPLGYPY------VNSVSSHASSPYISSV- 87

  Fly   242 LPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLM 306
                                          ::.|....|.:    .|.:|.|             
Mouse    88 ------------------------------QSYPGSASLAQ----SRLEDPG------------- 105

  Fly   307 LDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRT 371
                               :||::..:.|   |..:.:            ||.   |.:.::.||
Mouse   106 -------------------ADSEKSTVVE---GGEVRF------------NGK---GKKIRKPRT 133

  Fly   372 AYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK-----LPNTK 431
            .|:..|:..|.:.|...:||....|.|:|.:|.|::.|:||||||:|.|:||..|     |..:.
Mouse   134 IYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSA 198

  Fly   432 NVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVS 496
            ....:.:.|...|.|....|                                 .|.|.:..|   
Mouse   199 LANGRALSAGSPPVPPGWNP---------------------------------NSSSGKGSG--- 227

  Fly   497 SSLGNPPYIPAAPETTSSYPGSQQ 520
            ||.|:  |:|:   .||.||.:.|
Mouse   228 SSAGS--YVPS---YTSWYPSAHQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
Dlx1NP_034183.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 8/35 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..118 8/61 (13%)
Homeobox 131..185 CDD:395001 22/53 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..233 10/66 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.