DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP001560

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_321553.2 Gene:AgaP_AGAP001560 / 1281608 VectorBaseID:AGAP001560 Length:338 Species:Anopheles gambiae


Alignment Length:157 Identity:64/157 - (40%)
Similarity:79/157 - (50%) Gaps:27/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 MEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLP 428
            :..||.|||:|..|:||||:||..|.||||.||||||..|.|||:|:||||||||:|.||.: .|
Mosquito   194 LSSKRIRTAFTSTQLLELEREFAGNMYLTRLRRIEIATRLRLSEKQVKIWFQNRRVKRKKGD-AP 257

  Fly   429 NTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIG 493
            ....:      :.|..:||.    .|.:.|:|||.|..|..             |.|...... |
Mosquito   258 FGAEL------SGGVSSPVG----GRNSPKEQQQQQHGQHC-------------CCRGSHCGG-G 298

  Fly   494 DVSSSLGNPPYIPAAPETTSSYPGSQQ 520
            ..|.|...|.  .:|.:.|.|..||||
Mosquito   299 GGSDSEDLPQ--RSAEDRTHSPVGSQQ 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
AgaP_AGAP001560XP_321553.2 Homeobox 200..252 CDD:278475 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.