DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP009646

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_318681.1 Gene:AgaP_AGAP009646 / 1279024 VectorBaseID:AGAP009646 Length:394 Species:Anopheles gambiae


Alignment Length:471 Identity:129/471 - (27%)
Similarity:168/471 - (35%) Gaps:148/471 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 HSHTHSLPHHHSNSAISGHHQASAGGYSSNYANATPPSHP---------------HSHPHA-HPH 149
            ::|....|.:||.:.   .:.|:.|.|.|||.:  .|.||               :.|||. ||.
Mosquito     5 YNHFAMYPKNHSGNL---PYSATTGWYPSNYQH--QPPHPQFIGDGESSPQPAMYYPHPHVFHPQ 64

  Fly   150 QSLGYYVHH---APEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGA--VGGSAN- 208
            .|..:..|.   .|...|.|..|       ||:.....|.:||.|||||.: |.||  :|.:.| 
Mosquito    65 SSPDWSSHENFSTPPQTSLGLSH-------GPSPGAGGTGSGGSGGGSGGI-GSGALHLGQNPNL 121

  Fly   209 ------GYYGGYGGGYGTANGSVGSTHSQ-GHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKL 266
                  .::|..|||.|...||.|:.|.. ....||    :|      .||...           
Mosquito   122 HHHHHHHHHGNNGGGNGGGGGSGGNAHDHLADGLHS----IP------SPPITV----------- 165

  Fly   267 EKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDED 331
                     :|..:...|.     ..||.:..::.....:  :||                    
Mosquito   166 ---------SGSDMSSPGA-----PTGSSSPQITPRPTPV--KSP-------------------- 194

  Fly   332 LMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRT------AYTRHQILELEKEFHYNRY 390
                        |.||||        .|||....|.:.||      .||..|.|||||||||.||
Mosquito   195 ------------YEWMKK--------QSYQSQPNPGKTRTKDKYRVVYTDQQRLELEKEFHYTRY 239

  Fly   391 LTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVA-----KK 450
            :|.||:.|:|..|.|||||:||||||||.|.:|..|...|.:|........|..:.||     ..
Mosquito   240 ITIRRKAELAQNLQLSERQVKIWFQNRRAKDRKQKKKAETGSVGGGMGGLGGGQSLVAAHAQGHN 304

  Fly   451 PTKRAASKKQQQAQQQQQSQQQQTQQT-PVMNECIRSDSLESIGDVSSSLG------NPPYIPAA 508
            |...||           ||.......| |.:...:....|..:..:|..:|      :.|...||
Mosquito   305 PHGGAA-----------QSMSALLADTKPKLEPSLHLSHLHQMSAMSMGMGSMGLHHHHPGHHAA 358

  Fly   509 PETTSSYPGSQQHLSN 524
            .......|.||.|..|
Mosquito   359 LHAHLGVPTSQHHQLN 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/57 (63%)
AgaP_AGAP009646XP_318681.1 Homeobox 219..272 CDD:365835 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.