DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP005099

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_313975.4 Gene:AgaP_AGAP005099 / 1274774 VectorBaseID:AGAP005099 Length:276 Species:Anopheles gambiae


Alignment Length:311 Identity:67/311 - (21%)
Similarity:104/311 - (33%) Gaps:116/311 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 MKKIHVA-GVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQI 410
            :..:|.| |....:.:.|.:.||.||.:|..|:.|||:.|....|.....|.|||..:.|:|.::
Mosquito     1 LTSLHGATGFGQNADKHGAKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRV 65

  Fly   411 KIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNP------------------------------- 444
            ::||||||.||||..|..|........:.::|.|                               
Mosquito    66 QVWFQNRRAKWKKRKKTTNVFRTPGALLPSHGLPPFGANITNIAMSESLCGTSMFGGDRWGVGVN 130

  Fly   445 ----------------------TPVAKKPTKRAAS---------------KKQQQAQQQQQSQQQ 472
                                  :|.:..|...|.|               .:|||..||||.|||
Mosquito   131 PMTAGDTMMYQHSVGGVGCTGGSPTSTPPNINACSPSTPPLTNSGQQPNQPQQQQPHQQQQQQQQ 195

  Fly   473 QTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGSGNNNNNN 537
            |.||                                         .||..|.|:.:.:|..:..|
Mosquito   196 QQQQ-----------------------------------------QQQGASQNDASANGEMSGPN 219

  Fly   538 NNNNSNLNNNNNNNQMGHTNL-HGH----LQQQQSDLMTNLQLHI-KQDYD 582
            .:...|..:.:.....|..:: .||    |:::.|:|...:..:: ..:||
Mosquito   220 QHGIGNCQSLSAGTPDGDEDVWRGHSIAALRRRASELNQTMPSYLHAHNYD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
AgaP_AGAP005099XP_313975.4 Homeobox 24..72 CDD:278475 18/47 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.