DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP003674

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_313455.4 Gene:AgaP_AGAP003674 / 1274348 VectorBaseID:AGAP003674 Length:314 Species:Anopheles gambiae


Alignment Length:347 Identity:78/347 - (22%)
Similarity:118/347 - (34%) Gaps:158/347 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 PAGQQLQELGMRLRCD-----------DMGSENDDMS--------EEDRLMLD----------RS 310
            |...:.|:|...:..|           :.|||:.|:.        ||..:..|          ||
Mosquito     4 PHEDEDQDLDQEINVDADSDCQSRVSYNSGSEDIDLDGDGNGSCYEESDIASDHQTHSTEPTTRS 68

  Fly   311 PDE---------LG-SNDNDDDLGDSDSDEDLMAETTDGERII---------------------- 343
            |:|         || |.|.|      ..|:|..:|.|..|.:|                      
Mosquito    69 PNENLPFSISRLLGKSYDRD------QKDKDAGSEDTGPEGLIKNGHHITVSSPSSLQYAAGALY 127

  Fly   344 ----YP------------------W-MKKIHVAGVANGS-----------------YQPGMEPKR 368
                ||                  | :..:|.|.:|:.:                 ||....|||
Mosquito   128 SYPMYPGGHVLRVPPQRGPCNPLSWTLPPLHPAALAHQAVKDRLAAFPIARRIGHPYQNRTPPKR 192

  Fly   369 Q--RTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTK 431
            :  ||::||.|:.||||.||..:||....|..:|..|.:::.|:|.||||||.||::        
Mosquito   193 KKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRR-------- 249

  Fly   432 NVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVS 496
                                          |..:::::::|      ..|..:.|...|::   |
Mosquito   250 ------------------------------QTAEEREAERQ------AANRLMLSLQAEAL---S 275

  Fly   497 SSLGNPPYIPAAPETTSSYPGS 518
            ...|.||...|||..|:  ||:
Mosquito   276 KGFGQPPPSAAAPSATT--PGA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
AgaP_AGAP003674XP_313455.4 COG5576 143..270 CDD:227863 39/170 (23%)
Homeobox 195..248 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.