DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP010358

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_559100.2 Gene:AgaP_AGAP010358 / 1272681 VectorBaseID:AGAP010358 Length:314 Species:Anopheles gambiae


Alignment Length:244 Identity:53/244 - (21%)
Similarity:95/244 - (38%) Gaps:57/244 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 KLEKRIEEAVPAGQQLQELGMRLR------CDDMGSENDDMSEEDRLMLDRSPDEL---GSNDND 320
            ::|.||||...|...:....:|.:      ||...:.:  :|...||:.....:::   |::..:
Mosquito    97 EIEARIEELRKANPGIFSWEIRDKLIKDGLCDKTSAPS--VSSISRLLRGGRREDVDLRGNHSIN 159

  Fly   321 DDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGM----EPKRQRTAYTRHQILEL 381
            ..||:|..|||...|:                        :||:    :.:|.||.:...|:..|
Mosquito   160 GILGESSCDEDSDTES------------------------EPGITLKRKQRRSRTTFNGEQLEAL 200

  Fly   382 EKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKD-----------NKLPNTKNVRK 435
            |..|...:|.....|.|:|....|:|.::::||.|||.:.:|.           ::.|:..:.:.
Mosquito   201 EIAFSRTQYPDVYTREELAQKTKLTEARVQVWFSNRRARLRKHMSSQQMVAFGASQYPSQFDQQA 265

  Fly   436 KTVDA----NGNPTPVAKKPTKRAASKKQQQA---QQQQQSQQQQTQQT 477
            ..|.|    :|:.:|:......:..|....||   ....||......||
Mosquito   266 AAVAAATASSGSGSPMGAGTWSQCYSSSPTQATTIHAPSQSSYNPLAQT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 17/51 (33%)
AgaP_AGAP010358XP_559100.2 PAX 19..144 CDD:238076 12/48 (25%)
Homeobox 188..241 CDD:278475 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.