DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP000190

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_310944.5 Gene:AgaP_AGAP000190 / 1272074 VectorBaseID:AGAP000190 Length:493 Species:Anopheles gambiae


Alignment Length:422 Identity:98/422 - (23%)
Similarity:141/422 - (33%) Gaps:149/422 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SPMSMGNGLDPKFPPLADDYHHYNGHYSMTASTGHMSGAVGGGAGVGSVGGGGAGGMTGHPHSMH 81
            :|.|:|:.:.........|....||              .|||.|    |||||||..|.|...:
Mosquito    18 TPSSLGDTMSDSAGLCLQDLVGVNG--------------TGGGGG----GGGGAGGTGGGPGGAN 64

  Fly    82 PADMVSDYM---AHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASA-------GGYSS----NYA 132
              :.::|::   ..||.||:|     |||   |......|...:||       ||.:|    :..
Mosquito    65 --NTLADHLHGTGAHHGPHTH-----HSL---HDGLVSGGVSVSSAITSLMSPGGINSGGLGHLH 119

  Fly   133 NATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAV 197
            :..|....|.|.|.|.||      ||     .:.|:| :|.......|..               
Mosquito   120 HGAPDLSAHHHHHHHHHQ------HH-----HSSALH-EPLEKLKLWAET--------------- 157

  Fly   198 LGGGAVGGSANGYYGGYGGGYGTANGSVGS-THSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQE 261
                          |.:.....|...||.| .|:|...|.|.    |...||.:...:.:..:.|
Mosquito   158 --------------GDFRENSHTGMTSVSSIDHAQMGFPASS----PRNRSSRDRKNDVSRCINE 204

  Fly   262 LGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDS 326
            ..:|.|                          :.:..||.|                  |..|..
Mosquito   205 ASVKTE--------------------------NLSSGMSHE------------------DGTGSV 225

  Fly   327 DSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYL 391
            .....:..:.|||.:                 :.:.....:||||.:|..|:.|||:.|..|||.
Mosquito   226 APGTTIQQDGTDGTK-----------------NDKKNKRQRRQRTHFTSQQLHELEQTFSRNRYP 273

  Fly   392 TRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
            ....|.|||....|:|.::::||:|||.||:|
Mosquito   274 DMSTREEIAMWTNLTEARVRVWFKNRRAKWRK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 23/51 (45%)
AgaP_AGAP000190XP_310944.5 Homeobox 252..304 CDD:278475 23/51 (45%)
OAR 445..460 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.