DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Cdx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_034010.3 Gene:Cdx1 / 12590 MGIID:88360 Length:268 Species:Mus musculus


Alignment Length:114 Identity:53/114 - (46%)
Similarity:67/114 - (58%) Gaps:13/114 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 RIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVL 405
            |..|.||::...|....||.:...:.| .|..||.||.|||||||||:||:|.||:.|:|..|.|
Mouse   130 RTPYEWMRRSVAAAGGGGSGKTRTKDK-YRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGL 193

  Fly   406 SERQIKIWFQNRRMKWKKDNK--------LPNTKNVRKKTVDANGNPTP 446
            :|||:||||||||.|.:|.||        ||.|    :..:..:|.|||
Mouse   194 TERQVKIWFQNRRAKERKVNKKKQQQQQPLPPT----QLPLPLDGTPTP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
Cdx1NP_034010.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..152 7/21 (33%)
Caudal_act 13..138 CDD:282574 4/7 (57%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P47902 157..178 14/20 (70%)
Homeobox 158..210 CDD:278475 35/51 (69%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:P47902 196..207 9/10 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..268 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.