DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Barhl1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_476450.1 Gene:Barhl1 / 117232 RGDID:620648 Length:327 Species:Rattus norvegicus


Alignment Length:215 Identity:55/215 - (25%)
Similarity:90/215 - (41%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SPHSQMMDLPLQCSSTEPP------TNTALGLQELGLKLEKRIEE---AVPAGQQLQELGMRLR- 288
            ||.|:...   .|||...|      |:|:......|..|:..::.   :.||..:.......:| 
  Rat    39 SPRSESSS---DCSSPASPGRDCLETSTSRPGAASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRD 100

  Fly   289 ----------CDDMGSENDDMSEE--DRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGER 341
                      |....|.....:.|  .||......|.....|.......|||:..:..|   |:|
  Rat   101 ILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAGEDFRDKLDKSVSSASSDSEYKVKEE---GDR 162

  Fly   342 IIYPWMKKIHVAGVANGSYQPGM---EPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTL 403
                        .:::....|.:   :|::.|||:|.||:.:||:.|...:||:.:.|:|:|.:|
  Rat   163 ------------EISSSRDSPPVRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASL 215

  Fly   404 VLSERQIKIWFQNRRMKWKK 423
            .|::.|:|.|:||||.|||:
  Rat   216 NLTDTQVKTWYQNRRTKWKR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 24/51 (47%)
Barhl1NP_476450.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 13/53 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..181 14/82 (17%)
Homeobox 182..235 CDD:395001 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.