DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and LOC116406456

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002935721.1 Gene:LOC116406456 / 116406456 -ID:- Length:338 Species:Xenopus tropicalis


Alignment Length:203 Identity:56/203 - (27%)
Similarity:95/203 - (46%) Gaps:45/203 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 STEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPD 312
            :..|.::::|.||            ..|.....|::..:|..|...:||....:..::....|||
 Frog   166 NNNPESSSSLMLQ------------LNPRTSSKQQIPPQLHMDKKMNENPSSQDSGKVPSGESPD 218

  Fly   313 ELGSNDND-----------DDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEP 366
            ...::..|           .::.|.::.|::.::|....     |:              .....
 Frog   219 PKAAHQEDRSCLAEVSVSSPEVQDKETKEEIKSDTPTSN-----WL--------------TAKSG 264

  Fly   367 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTK 431
            :::|..||:||.|||||||.:|.||||.||:||:.::.|::||:||||||||||.|   |:....
 Frog   265 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLK---KMSREN 326

  Fly   432 NVRKKTVD 439
            .:|:.|.:
 Frog   327 RIRELTAN 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
LOC116406456XP_002935721.1 Homeobox 267..321 CDD:365835 35/56 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.