DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP013075

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_003435974.1 Gene:AgaP_AGAP013075 / 11175693 VectorBaseID:AGAP013075 Length:656 Species:Anopheles gambiae


Alignment Length:152 Identity:54/152 - (35%)
Similarity:76/152 - (50%) Gaps:23/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 ANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMK 420
            |..|....::.||.||.:|..|:..||.||...:|:....|:.:||||.|:|.|:|:||||||:|
Mosquito   512 AMSSSAASLKSKRVRTIFTPEQLERLEAEFERQQYMVGPERLYLAHTLQLTEAQVKVWFQNRRIK 576

  Fly   421 WKKDNKLPNTKN----VRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQ--------- 472
            |:| :.|..|:.    :|::.: |||.|.|        |...:....|||||.|||         
Mosquito   577 WRK-HHLEITQQRLALIRQRQI-ANGVPIP--------AGEVQPHHIQQQQQQQQQNGMSGGRIM 631

  Fly   473 QTQQTPVMNECIRSDSLESIGD 494
            ....:|.:..|..|....||.|
Mosquito   632 NAMDSPELTICTDSMDARSISD 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
AgaP_AGAP013075XP_003435974.1 Homeobox 526..578 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.