DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP013373

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_003436924.1 Gene:AgaP_AGAP013373 / 11175540 VectorBaseID:AGAP013373 Length:216 Species:Anopheles gambiae


Alignment Length:206 Identity:59/206 - (28%)
Similarity:79/206 - (38%) Gaps:45/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 VAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQN 416
            ||......|:.....::.|.||:..|:..||.||..|.||...:|.|:|..|.|:|.|||.||||
Mosquito     5 VASTLVKRYRKQNRERKPRQAYSAMQLERLEDEFQRNIYLNVNKRFELAQCLGLTETQIKTWFQN 69

  Fly   417 RRMKWKKDNKLPNTKNVRKKT-----------------VDANGNPTP-VAKKPTKRAASKKQQQA 463
            ||.|:||.....|.:..|::.                 :|....|.| :|..|..|::....|..
Mosquito    70 RRTKFKKQQDSRNKREQRQQAQLIAQWLFQPPQLGSIPLDGQLQPLPRLAALPVHRSSLALAQGT 134

  Fly   464 QQQ----------------QQSQQQQTQQTPVMNECIRSDS---LESIGDVSSSLGNPPYIPAAP 509
            .|.                ||.|.||        .|...|.   ::.:..|.|....|.:..|.|
Mosquito   135 LQSALMAPYHLLPPTSLTVQQHQHQQ--------RCALEDGPRVVKPVYTVRSPNAVPAFPTAVP 191

  Fly   510 ETTSSYPGSQQ 520
            ..|||...|.|
Mosquito   192 FATSSVVSSLQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 27/51 (53%)
AgaP_AGAP013373XP_003436924.1 Homeobox 22..75 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.