DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and ATHB54

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001322131.1 Gene:ATHB54 / 10723019 AraportID:AT1G27045 Length:252 Species:Arabidopsis thaliana


Alignment Length:157 Identity:38/157 - (24%)
Similarity:65/157 - (41%) Gaps:37/157 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTK 431
            ||:.|..   |:..||:.|...:.|...|::.:|..|.|...|:.:||||||.::|       ||
plant    69 KRKLTPI---QLRLLEESFEEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRARYK-------TK 123

  Fly   432 NVRKKTVDANGNPTPVAKKPT---------KRAASKKQ-------QQAQQQQQSQQQQTQQTPVM 480
            .:..   |.:......||..|         :...||.|       ...|:..|:.....:|..::
plant   124 QLEH---DCDSLKASYAKLKTDWDILFVQNQTLKSKVQFLNRLTSHYFQESVQNFDDTFKQVDLL 185

  Fly   481 NECIR-SDSLES-------IGDVSSSL 499
            .|.:: .::||:       :|:..||:
plant   186 KEKLKMQENLETQSIERKRLGEEGSSV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 17/51 (33%)
ATHB54NP_001322131.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.