DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_598793.2 Gene:Hoxb2 / 103889 MGIID:96183 Length:354 Species:Mus musculus


Alignment Length:189 Identity:65/189 - (34%)
Similarity:94/189 - (49%) Gaps:39/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 YPWMKK--------------------IHVAGVANGSYQPGME------PKRQRTAYTRHQILELE 382
            :||||:                    :..:.|.:.|..||:.      .:|.|||||..|:||||
Mouse    93 FPWMKEKKSTKKPSQSAASPSPAASSVRASEVGSPSDGPGLPECGGSGSRRLRTAYTNTQLLELE 157

  Fly   383 KEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKD---NKLPNTKNVRKKTVDANGNP 444
            ||||:|:||.|.||:|||..|.|:|||:|:||||||||.|:.   .:.|..:.......|..|.|
Mouse   158 KEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREPPEGEPGGPSAQDDAGEP 222

  Fly   445 TPVAKKPTKR---AASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLG 500
               |::||..   .|:.:.::|........|..:..|  ...:.:.:|||:|  :||.|
Mouse   223 ---AEEPTVSPGDVATHRLREACFHPAEAAQGPRGAP--PSALPATTLESVG--ASSPG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 37/51 (73%)
Hoxb2NP_598793.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..143 8/49 (16%)
Antp-type hexapeptide 92..97 2/3 (67%)
Homeobox 145..197 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 11/40 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..295 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.