DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxa2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_036713.2 Gene:Hoxa2 / 103690123 RGDID:2813 Length:372 Species:Rattus norvegicus


Alignment Length:234 Identity:72/234 - (30%)
Similarity:98/234 - (41%) Gaps:62/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 YPWMKKIHVA-----------------------GVANGSYQPGMEPKRQRTAYTRHQILELEKEF 385
            |||||:...|                       .:|:||   |...:|.|||||..|:|||||||
  Rat    97 YPWMKEKKAAKKTALPPAAASTGPACLGHKESLEIADGS---GGGSRRLRTAYTNTQLLELEKEF 158

  Fly   386 HYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGN------- 443
            |:|:||.|.||:|||..|.|:|||:|:||||||||.|:..:....:|...|..:...:       
  Rat   159 HFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDE 223

  Fly   444 --------PTPVAKKPTKRAASKKQQQAQQQQQS---QQQQTQQTPVMNECIRSDSLESIGDVSS 497
                    ...|:....:|.....||.|..|||:   ....:|..||........:|:.....| 
  Rat   224 EEKSLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQTFPVSPLTSNEKNLKHFQHQS- 287

  Fly   498 SLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGSGNNNNN 536
                    |..|...|:.         ..|.|:|.||::
  Rat   288 --------PTVPNCLSTM---------GQNCGAGLNNDS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 37/51 (73%)
Hoxa2NP_036713.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..96
Antp-type hexapeptide 96..101 3/3 (100%)
Homeobox 143..196 CDD:395001 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 3/30 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.