DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxd11

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_008760183.3 Gene:Hoxd11 / 102553842 RGDID:7730597 Length:336 Species:Rattus norvegicus


Alignment Length:362 Identity:93/362 - (25%)
Similarity:127/362 - (35%) Gaps:118/362 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 YSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYG-PAANVPNTSNGGG 190
            ||||.|           ||..|.:.:.:                   ..|| ..|..|....|||
  Rat    47 YSSNLA-----------PHVQPVREVAF-------------------RDYGLERAKWPYRGGGGG 81

  Fly   191 GGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHS--------PHSQMMDLPLQ-- 245
            |.|.|   |||..||...| .|||...|..|..:..:..:...:        |..:..|:..:  
  Rat    82 GAGGG---GGGGPGGGGGG-SGGYAPYYAAAAAAAAAAAAAEEAAMQRDLLPPAGRRPDVLFKAP 142

  Fly   246 ---CSSTEPPTNTAL------------GLQELGLKLEKRIEEAVP----AGQQLQELGMRLRCDD 291
               |.:..||...|.            |:...|.   .:..||.|    ||.|.|.         
  Rat   143 EPVCGAPGPPHGPAAAASNFYSAVGRNGILPQGF---DQFYEAAPGPPFAGPQPQP--------- 195

  Fly   292 MGSENDDMSEEDRLMLDRSPDELGSND-NDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGV 355
                           ....|...|:.| .|...|.........::.|.|     |..|.....|.
  Rat   196 ---------------APAPPQPEGAADKGDPKAGAGGGGGSPCSKATPG-----PEPKGAAEGGG 240

  Fly   356 ANGSYQPG----------MEPKR---QRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSE 407
            ..|...||          :.|:|   :|..||::||.|||:||.:|.|:.:.:|::::..|.|::
  Rat   241 GEGEGPPGEAGAEKSGGTVAPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLSRMLNLTD 305

  Fly   408 RQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNP 444
            ||:||||||||||.||.|        |.:.....|||
  Rat   306 RQVKIWFQNRRMKEKKLN--------RDRLQYFTGNP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 27/51 (53%)
Hoxd11XP_008760183.3 DUF3528 26..187 CDD:403310 40/176 (23%)
Homeobox 267..321 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.