DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxa7

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001363856.1 Gene:hoxa7 / 101734257 XenbaseID:XB-GENE-483655 Length:207 Species:Xenopus tropicalis


Alignment Length:262 Identity:86/262 - (32%)
Similarity:112/262 - (42%) Gaps:92/262 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 SANGYYGGYGGGYGTANGSVGSTHS----QGHSP-HSQMMD-LPLQCSSTEPPTNTALGLQELGL 264
            ::|...||||.|.|....||.|.::    |...| :|...| ..|.|||                
 Frog    32 ASNSQRGGYGTGTGPFPSSVPSLYNSPLYQNPFPAYSLASDSYNLHCSS---------------- 80

  Fly   265 KLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSD 329
                 .::.:|           |.|:::                                 ..::
 Frog    81 -----FDQNIP-----------LLCNEL---------------------------------PKAE 96

  Fly   330 EDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRR 394
            |..:.:..|....|||||:            ..|.:.||.|..|||:|.||||||||:|||||||
 Frog    97 EAALHQQADSHFRIYPWMR------------SSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRR 149

  Fly   395 RRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKK 459
            |||||||.|.|:|||||||||||||||||::     |....:|.||..:.|    .||..|..|.
 Frog   150 RRIEIAHALCLTERQIKIWFQNRRMKWKKEH-----KEESGQTPDAGEDST----APTTTAEDKD 205

  Fly   460 QQ 461
            ::
 Frog   206 KE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 43/51 (84%)
hoxa7NP_001363856.1 Homeobox 125..178 CDD:365835 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.