DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and LOC101731251

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_017951762.1 Gene:LOC101731251 / 101731251 -ID:- Length:882 Species:Xenopus tropicalis


Alignment Length:42 Identity:13/42 - (30%)
Similarity:19/42 - (45%) Gaps:6/42 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 QQSQQQQTQQTPVMNECIR----SDSL--ESIGDVSSSLGNP 502
            |.:.|...|..|.:|.|.|    .::|  |.|..:.|.|.:|
 Frog   659 QVNAQYLKQLQPYLNRCTRLWMGENNLDTEMITVICSLLESP 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475
LOC101731251XP_017951762.1 DD 27..105 CDD:387368
FISNA 123..196 CDD:373091
P-loop_NTPase 208..373 CDD:393355
NOD2_WH 449..506 CDD:375327
NLRC4_HD2 508..609 CDD:375325
LRR_RI <618..>770 CDD:393385 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.