powered by:
Protein Alignment Dfd and LOC101731251
DIOPT Version :9
Sequence 1: | NP_477201.1 |
Gene: | Dfd / 40832 |
FlyBaseID: | FBgn0000439 |
Length: | 586 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017951762.1 |
Gene: | LOC101731251 / 101731251 |
-ID: | - |
Length: | 882 |
Species: | Xenopus tropicalis |
Alignment Length: | 42 |
Identity: | 13/42 - (30%) |
Similarity: | 19/42 - (45%) |
Gaps: | 6/42 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 467 QQSQQQQTQQTPVMNECIR----SDSL--ESIGDVSSSLGNP 502
|.:.|...|..|.:|.|.| .::| |.|..:.|.|.:|
Frog 659 QVNAQYLKQLQPYLNRCTRLWMGENNLDTEMITVICSLLESP 700
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.