DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxa4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_077326.1 Gene:Hoxa4 / 100912525 RGDID:2814 Length:285 Species:Rattus norvegicus


Alignment Length:462 Identity:140/462 - (30%)
Similarity:163/462 - (35%) Gaps:209/462 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFLMGYPHAPHHVQSPMSMGNGLDPKFPPLADDYHHYNGHYSMTASTGHMSGAVGGGAGVGSV 65
            |||||:.              .|.::|||||..:...|                  ||..|    
  Rat     3 MSSFLIN--------------SNYIEPKFPPFEEFAPH------------------GGPGG---- 31

  Fly    66 GGGGAGGMTGHPH---SMH-PADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGG 126
            |.||.||..|:|.   |.| ||.          |||:...:..:..|.....|...|.:.|.|..
  Rat    32 GDGGVGGGPGYPRPQSSPHLPAP----------NPHAARQTPAYYAPRAREPSYHGGLYPAPAAA 86

  Fly   127 --YSSNYAN-ATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNG 188
              |:...|: |.|...|  .|.|||..        ||:       ...|.....|....|     
  Rat    87 CPYACRGASPARPEQSP--APGAHPSP--------APQ-------PPAPPRRCAPGPTTP----- 129

  Fly   189 GGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPT 253
                   ||    |.||||                                              
  Rat   130 -------AV----ATGGSA---------------------------------------------- 137

  Fly   254 NTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSND 318
                              .|.|.                            |:.|:.|       
  Rat   138 ------------------PACPL----------------------------LLADQGP------- 149

  Fly   319 NDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEK 383
                           |.....|.::|||||||||:.| |.||..| ||||.||||||.|:|||||
  Rat   150 ---------------AGPKGKEPVVYPWMKKIHVSAV-NPSYNGG-EPKRSRTAYTRQQVLELEK 197

  Fly   384 EFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVA 448
            |||:||||||||||||||||.|||||:||||||||||||||:||||||.       .:.||....
  Rat   198 EFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKM-------RSSNPASAP 255

  Fly   449 KKPTKRA 455
            ..|..:|
  Rat   256 AGPPGKA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 46/51 (90%)
Hoxa4NP_077326.1 Homeobox 183..236 CDD:278475 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.