DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and LOC100911668

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_006257771.1 Gene:LOC100911668 / 100911668 RGDID:6491746 Length:413 Species:Rattus norvegicus


Alignment Length:395 Identity:104/395 - (26%)
Similarity:150/395 - (37%) Gaps:87/395 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GGGAGVGSVGGGGAGGMTGHPHSMHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQ 121
            |||.|    ||||..|...|.::..|.|:..|                  .|.........|...
  Rat    94 GGGGG----GGGGGLGPGAHGYAPAPLDLWLD------------------APRSCRMEPPDGPPP 136

  Fly   122 ASAGGYSSNYANATPPSHPHSHPHA-------HPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPA 179
            ..............||..|...|.|       :..:...|.::.:.:....|:..:|       .
  Rat   137 PQPQPQQQQQPPPPPPQPPQPPPQATSCSFAQNIKEESSYCLYDSADKCPKGSAAAD-------L 194

  Fly   180 ANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPL 244
            |..|.     |....|..||..: |....||: .....||||.|.......|..||      .|.
  Rat   195 APFPR-----GPPPDGCALGASS-GVPVPGYF-RLSQAYGTAKGFGSGGTQQLASP------FPA 246

  Fly   245 QCSST--EPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLML 307
            |....  :||:..|.|..|...|  :|:.::.|....:...|...:.|:....:...:||    |
  Rat   247 QPPGRGFDPPSALASGSAEAAGK--ERVLDSTPPPTLVCAGGGSSQADEEAHASSSAAEE----L 305

  Fly   308 DRSPDELG-SNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRT 371
            ..:|.|.. ::...|.||:|.|:                        ..||  :......:::|.
  Rat   306 SPAPSENSKASPEKDSLGNSKSE------------------------NAAN--WLTAKSGRKKRC 344

  Fly   372 AYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKK 436
            .||:||.|||||||.:|.||||.||:||:.::.|::||:||||||||||.||.|:   ...:|:.
  Rat   345 PYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNR---ENRIREL 406

  Fly   437 TVDAN 441
            |.:.|
  Rat   407 TANFN 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
LOC100911668XP_006257771.1 Homeobox 342..395 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.