Sequence 1: | NP_477201.1 | Gene: | Dfd / 40832 | FlyBaseID: | FBgn0000439 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002935225.2 | Gene: | mnx1 / 100496534 | XenbaseID: | XB-GENE-919890 | Length: | 338 | Species: | Xenopus tropicalis |
Alignment Length: | 197 | Identity: | 59/197 - (29%) |
---|---|---|---|
Similarity: | 87/197 - (44%) | Gaps: | 71/197 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 344 YPWMKKIHVA-------GVANGSYQ---------PGME-PK-----------------RQRTAYT 374
Fly 375 RHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVD 439
Fly 440 ANGNPTPVAKKPTKRAASKKQ------------QQAQQQQQSQQQQTQQTPVM--NECIR--SDS 488
Fly 489 LE 490 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dfd | NP_477201.1 | Homeobox | 370..422 | CDD:278475 | 31/51 (61%) |
mnx1 | XP_002935225.2 | Homeobox | 180..234 | CDD:395001 | 32/53 (60%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |