DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and mnx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002935225.2 Gene:mnx1 / 100496534 XenbaseID:XB-GENE-919890 Length:338 Species:Xenopus tropicalis


Alignment Length:197 Identity:59/197 - (29%)
Similarity:87/197 - (44%) Gaps:71/197 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 YPWMKKIHVA-------GVANGSYQ---------PGME-PK-----------------RQRTAYT 374
            ||.|:..|.|       .::.|::|         .||. ||                 |.|||:|
 Frog   121 YPQMQGAHHAHHPVDPIKISAGTFQLDQWLRASTAGMMLPKMADFNSQAQSNLLGKCRRPRTAFT 185

  Fly   375 RHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVD 439
            ..|:||||.:|..|:||:|.:|.|:|.:|:|:|.|:||||||||||||:..|             
 Frog   186 SQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKK------------- 237

  Fly   440 ANGNPTPVAKKPTKRAASKKQ------------QQAQQQQQSQQQQTQQTPVM--NECIR--SDS 488
                    ||:...:.|.|:|            ::.|:.:.|.....:..|:.  :..:|  |||
 Frog   238 --------AKEQAVQDAEKQQRAGKGSCEEKCPEELQEDKNSYHLHPRGDPIKGNSRLVRDYSDS 294

  Fly   489 LE 490
            .|
 Frog   295 EE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 31/51 (61%)
mnx1XP_002935225.2 Homeobox 180..234 CDD:395001 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.