DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and prrx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_004913839.1 Gene:prrx1 / 100494324 XenbaseID:XB-GENE-484663 Length:248 Species:Xenopus tropicalis


Alignment Length:197 Identity:41/197 - (20%)
Similarity:79/197 - (40%) Gaps:39/197 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 PAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDG 339
            |.|.:| |..:....|::.::. :.|....|.|:.:.:.:|:...|   |..::...|:..    
 Frog    15 PLGSRL-ESPITASLDNLQAKK-NFSVSHLLDLEEAGEMVGAQAED---GSGEAGRSLLES---- 70

  Fly   340 ERIIYPWMKKIHVAGVANGSYQPGME-------------PKRQRTAYTRHQILELEKEFHYNRYL 391
                         .|:.:||..|..|             .:|.||.:...|:..||:.|....|.
 Frog    71 -------------PGLTSGSDTPQQENEQMNAEQKKKRKQRRNRTTFNSSQLQALERVFERTHYP 122

  Fly   392 TRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL----PNTKNVRKKTVDANGNPTPVAKKPT 452
            ....|.::|..:.|:|.::::||||||.|::::.:.    .|...::....|......|:..:|.
 Frog   123 DAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYAGDVTAVEQPIVPRPA 187

  Fly   453 KR 454
            .|
 Frog   188 PR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 18/51 (35%)
prrx1XP_004913839.1 Homeobox 102..154 CDD:365835 17/51 (33%)
OAR 221..238 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.