DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb8

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002938067.1 Gene:hoxb8 / 100493882 XenbaseID:XB-GENE-990961 Length:243 Species:Xenopus tropicalis


Alignment Length:290 Identity:82/290 - (28%)
Similarity:120/290 - (41%) Gaps:105/290 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 VGGSANGYYGGYGGG------------YGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNT 255
            :||.....||...||            :||.:.|         ||..|.....:.|.. :|  .:
 Frog    32 LGGRPTVVYGASAGGTFQHPGQIQDFYHGTPSLS---------SPTYQQNPCAVTCHG-DP--GS 84

  Fly   256 ALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDND 320
            ..|...|                |.|.|               .|.:|..::..|..:|.|    
 Frog    85 FYGYDPL----------------QRQSL---------------FSSQDTELVQYSECKLAS---- 114

  Fly   321 DDLG-DSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKE 384
            ..|| :::|.|...:.|.     ::|||:....||           .:|.|..|:|:|.||||||
 Frog   115 AGLGEEAESSEQSPSPTQ-----LFPWMRPQAAAG-----------RRRGRQTYSRYQTLELEKE 163

  Fly   385 FHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDN---KLPNTKNVRKKTVDANGNPTP 446
            |.:|.||||:||||::|.|.|:|||:|||||||||||||:|   |.|::|               
 Frog   164 FLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSK--------------- 213

  Fly   447 VAKKPTKRAASKKQQQAQQQQQSQQQQTQQ 476
                       .:|::.::|:..:.|.|::
 Frog   214 -----------CEQEELEKQKMERGQDTEE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
hoxb8XP_002938067.1 Homeobox 149..202 CDD:365835 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.