DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and barhl2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_012817899.1 Gene:barhl2 / 100493839 XenbaseID:XB-GENE-482777 Length:359 Species:Xenopus tropicalis


Alignment Length:371 Identity:81/371 - (21%)
Similarity:140/371 - (37%) Gaps:68/371 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 NTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSS 248
            :|.....|..|..:|.|......|..:   .|.|..:.:..:.:..|...||.|..|:...|...
 Frog     9 DTILSNAGAVSPGMLSGDFRDARATDF---RGQGPLSPDSEIDTVGSSPSSPISVTMEPVDQHRL 70

  Fly   249 TEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLD----- 308
            .:...::|..||.|     ...::..|..||..:||...|.........|:..:.:.:..     
 Frog    71 VDSVHHSAQHLQHL-----HPTQQQSPQQQQPPQLGSAPRTSTSSFLIKDILGDSKPLAACAPYS 130

  Fly   309 ---RSPDELGSNDNDDDLGDSDS-DEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPG------ 363
               .||.....::.:   |.|:| ...|..|..||:.......:.:|.....:|:.:.|      
 Frog   131 TTVPSPHHTPKHEGN---GSSESFRPKLEQEMQDGKGKAEKIREDLHTDIKGHGTKEEGDREITS 192

  Fly   364 ---------MEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRM 419
                     .:|::.|||::.||:.:||:.|...:||:.:.|:::|..|.|::.|:|.|:||||.
 Frog   193 SRESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRT 257

  Fly   420 KWKKDNKLPNTKNVRKKTVDANGN--------PTPVAKKP---------TKRAASKKQQQAQQQQ 467
            |||:...      |..:.:...||        |:|....|         |..||:.....:..:.
 Frog   258 KWKRQTA------VGLELLAEAGNYSALQRMFPSPYFYHPSLLSSMDSTTAAAAAAAMYSSMYRT 316

  Fly   468 QSQQQQTQQTPVMNECIRSDSLESIG----DVSSSLGNPPYIPAAP 509
            ........|.|::...:    :..:|    ...:.||||  ||..|
 Frog   317 PPAPHPQLQRPLVPRVL----IHGLGPGGQPALNPLGNP--IPGTP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
barhl2XP_012817899.1 Homeobox 208..261 CDD:365835 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.